General Information

  • ID:  hor007112
  • Uniprot ID:  Q00604
  • Protein name:  Norrin
  • Gene name:  FSHB
  • Organism:  Homo sapiens
  • Family:  NA
  • Source:  Human
  • Expression:  Expressed in the outer nuclear; inner nuclear and ganglion cell layers of the retina; and in fetal and adult brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0042803 protein homodimerization activity; GO:0005125 cytokine activity; GO:0005109 frizzled binding
  • GO CC:  GO:0006544 glycine metabolic process; GO:0031290 retinal ganglion cell axon guidance; GO:0006749 glutathione metabolic process; GO:0035426 extracellular matrix-cell signaling; GO:0003406 retinal pigment epithelium development; GO:0060221 retinal rod cell differentiation; GO:0007224 smoothened signaling pathway; GO:0060856 establishment of blood-brain barrier; GO:1990963 establishment of blood-retinal barrier; GO:0035640 exploration behavior; GO:0045446 endothelial cell differentiation; GO:0061304 retinal blood vessel morphogenesis; GO:0045893 positive regulation of DNA-templated transcription; GO:0002088 lens development in camera-type eye; GO:0001508 action potential; GO:0001525 angiogenesis; GO:0001974 blood vessel remodeling; GO:0006622 protein targeting to lysosome; GO:0016567 protein ubiquitination; GO:0000320 re-entry into mitotic cell cycle; GO:0048678 response to axon injury; GO:0097601 retina blood vessel maintenance; GO:0060070 canonical Wnt signaling pathway; GO:0006954 infl

Sequence Information

  • Sequence:  TDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
  • Length:  108
  • Propeptide:  MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
  • Signal peptide:  MRKHVLAASFSMLSLLVIMGDTDS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA